PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490074.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 351aa    MW: 39826.1 Da    PI: 7.0727
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490074.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.94.5e-281568155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+Wt++LH+rF+ea +qLGG+e +tPk++++lm+++gLtl+h+kSHLQkYRl
  XP_004490074.1 15 KPRLKWTHDLHQRFIEATNQLGGAE-TTPKSLMRLMGIPGLTLYHLKSHLQKYRL 68
                    79*******************9998.9***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-281370IPR009057Homeodomain-like
SuperFamilySSF466893.23E-151469IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-201569IPR006447Myb domain, plants
PfamPF002496.7E-71767IPR001005SANT/Myb domain
PfamPF143792.1E-21110156IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MKNQSKHFVL SSNAKPRLKW THDLHQRFIE ATNQLGGAET TPKSLMRLMG IPGLTLYHLK  60
SHLQKYRLGK SQQLEKYSDN KQEDYTETKS FDGHCSREIS LGENQINENM HIADALEMQM  120
EVEKKLYEQI EVQKHLQLRI EAQGKYLQSV LSKAHEALST YNSSSIGIKL KKSELSQLVI  180
MINNACPNSP ISEVIENGKL SLNSEERKMD RGTICSLESS LISCESSKRK EEKHSIEGLT  240
NSSTISLELP LMTMQSEEKS VSCLVSESVS VSDNLSNETN ERKRNAATES DGNYIEQCSY  300
KKRCGNKMKK EKLSKMFDLN RQCENEMDST SSKILLDLNC SLIYGNHEDG L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490074.10.0PREDICTED: uncharacterized protein LOC101501127 isoform X2
TrEMBLG7KGL21e-155G7KGL2_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA01G05920.21e-143(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.16e-67G2-like family protein